PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0277s0030.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MIKC_MADS
Protein Properties Length: 203aa    MW: 23221 Da    PI: 10.0514
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0277s0030.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.11.1e-28959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         k+ien + rqvtfskRr g++KKA+ELSvLCda+va iifs++g+lye++s
  Cagra.0277s0030.1.p  9 KKIENVTSRQVTFSKRRSGLFKKAHELSVLCDAQVAAIIFSQKGRLYEFAS 59
                         68***********************************************86 PP

2K-box59.41.6e-20851681194
                K-box  11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 
                          e+  + l++e+  + k+ie L+  +R+l+G++L  +s+keLq + +q+eksl  +Rs+K +l+ +++++l+ ke el++e  +L
  Cagra.0277s0030.1.p  85 EQYVQGLKKEMVAMVKKIEVLEVHNRKLMGQSLAFCSVKELQDIANQIEKSLHIVRSTKAKLYEDELKKLKPKEGELKDERVRL 168
                          56678999**************999*****************************************************998877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.7E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.637161IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.35E-31376IPR002100Transcription factor, MADS-box
CDDcd002652.13E-39373No hitNo description
PRINTSPR004041.5E-29323IPR002100Transcription factor, MADS-box
PfamPF003196.2E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-293859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129711.25488178IPR002487Transcription factor, K-box
PfamPF014862.6E-2089171IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MVRGKIEIKK IENVTSRQVT FSKRRSGLFK KAHELSVLCD AQVAAIIFSQ KGRLYEFASS  60
DIKKTIKRYS EYKREYFGAE SHPIEQYVQG LKKEMVAMVK KIEVLEVHNR KLMGQSLAFC  120
SVKELQDIAN QIEKSLHIVR STKAKLYEDE LKKLKPKEGE LKDERVRLCG RVGEMSMGMP  180
SESKEKEDVE TDLSIGFSKS RP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-20172172Myocyte-specific enhancer factor 2B
1tqe_Q2e-20172172Myocyte-specific enhancer factor 2B
1tqe_R2e-20172172Myocyte-specific enhancer factor 2B
1tqe_S2e-20172172Myocyte-specific enhancer factor 2B
3kov_A2e-20393289Myocyte-specific enhancer factor 2A
3kov_B2e-20393289Myocyte-specific enhancer factor 2A
3kov_I2e-20393289Myocyte-specific enhancer factor 2A
3kov_J2e-20393289Myocyte-specific enhancer factor 2A
3p57_A2e-20393289Myocyte-specific enhancer factor 2A
3p57_B2e-20393289Myocyte-specific enhancer factor 2A
3p57_C2e-20393289Myocyte-specific enhancer factor 2A
3p57_D2e-20393289Myocyte-specific enhancer factor 2A
3p57_I2e-20393289Myocyte-specific enhancer factor 2A
3p57_J2e-20393289Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ4470610.0DQ447061.1 Arabidopsis thaliana clone pENTR221-At5g51860 MADS-box protein (At5g51860) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006280982.11e-141hypothetical protein CARUB_v10026982mg, partial
SwissprotQ9FLH51e-120AGL72_ARATH; MADS-box protein AGL72
TrEMBLR0GNE91e-141R0GNE9_9BRAS; Uncharacterized protein (Fragment)
STRINGBra028282.1-P1e-121(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51860.21e-109MIKC_MADS family protein